Hyd-S11-1
Protein sequence:
MIRQLIEVDRVRTIAVAGYSLGGNLTLKLAGELADAAPPELKAVCAVSPTMDLAVCVEALERKSNILYEWNFVRNLKARMRLKSALWPGTFDLAGLRHVKTVRQFDDAYTAPHHGFRDAADYYHRASAMRIIDRIRIPALIVTAEDDPFVPAEPFRDPLVTNNPNLTVVVTPTGGHCAFVERAEPDYDGYWAEREIVRFATAHLAGPRAPQHPAKLMAL
Plasmid Profile:
PCR Gel Charts:
M: Marker, 2000 bp; Line20: Hyd-S11-1(564 bp)
Results of Western Blot:
M:Maker; C: CK; Line6: Hyd-S11-1,24.36kDa
Loss of Weight (rate of degradation of original membrane weight, etc.): 0.423%
Line1: CK; Line6: Hdy-S11-1;
Polyethylene film weight loss (0.01 < P < 0.05 labelled *, 0.001 < P <0.01 labelled **, P < 0.001 labelled ***, P > 0.05 indicates no statistical significance labelled ns)
Scanning Electron Microscope Image: Fourier Diagram:
Plastic Film(Carbonyl index(CI):2.22%)
Plastic Microspheres(Carbonyl index(CI):3.50%)